HORDB

ID: hor001918
Uniprot ID: Q91971
Protein name: Glucagon-like peptide 1-2
Gene name: gcg1
Organism: Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Family: Glucagon family
Source: animal
Expression: Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
Disease: NA
Comments: NA
Taxonomy: Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0050896 response to stimulus
GO CC: GO:0005576 extracellular region

Sequence: HADGTYTSDVSTYLQDQAAKDFVSWLKSGPA
Length: 31
Propeptide: MFGIHSLAGVLLLVIVQRQLASPLQEAEDNSSLETTDPLLEDLMGVSNVKRHSEGTFSNDYSKYQEERMAQDFVQWLMNSKRSGAPSKRHADGTYTSDVSTYLQDQAAKDFVSWLKSGRARRESAEESRNGPMSRRHVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSGKSNKRQEDH
Signal peptide: MFGIHSLAGVLLLVIVQRQLA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001918_AF2.pdb

hor001918_ESM.pdb

Mass:	389491	Formula:	C149H220N38O51
Absent amino acids:	CEIMNR	Common amino acids:	ADS
pI:	4.45	Basic residues:	3
Polar residues:	11	Hydrophobic residues:	10
Hydrophobicity:	-55.48	Boman Index:	-5096
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	56.77
Instability Index:	2321.29	Extinction Coefficient cystines:	8480
Absorbance 280nm:	282.67